PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g034260.1
Common NameMTR_2g034260, MtrDRAFT_AC152185g34v2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GRAS
Protein Properties Length: 587aa    MW: 67296.7 Da    PI: 4.9391
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g034260.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.71.7e-922085842374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn........sseelaalklfsev 87 
                       e Ll+cAe v  ++ e+a++lL +++ l+s++g+p++R+++yf+eAL++r+ +++ +++ + +  ++            +++   al +f++ 
  Medtr2g034260.1 208 AESLLACAEKVGYQQYERARKLLLQIESLSSKTGNPVKRVVHYFAEALRQRIDKETGRVSVSTNNMKKM--GplfdpqevTKDLNPALVAFFQD 299
                      578***************************************************766666444333222..1233444434444455566**** PP

             GRAS  88 sPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg.skeeleetgerLakfAeelgvpfefn 179
                       P+ k+s +t+ q++ e v +++++H+iD++i +GlQW  L+qaL sR++ p   l+iT+++  + +  k+ +e tg+rL++fA+ l++pf f+
  Medtr2g034260.1 300 LPFCKISMFTCVQTLIENVTNAKKIHVIDLEIRKGLQWTILMQALQSRNKCPVeLLKITAIVTGNIEtLKNIVEDTGKRLKDFARYLNIPFLFD 393
                      *************************************************7665499*******777778999********************** PP

             GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                      ++++++l  l+ + ++++++E++aV ++++l++  ++s +le     ++++v++++Pkv+vv+e ea+hns+sF++rf+eal y+sa+fd++e 
  Medtr2g034260.1 394 TIIVSDLLHLREDLFKIDSEETVAVYSQFALQSKIQQSDQLET----IMRVVRTINPKVMVVAEIEANHNSKSFVNRFIEALFYFSAFFDCFED 483
                      **********************************988888888....*********************************************99 PP

             GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrp 366
                       + +++e+r+ +E +++g  i+n+va egaer+ r+ +   Wr+ + ++G+ + +ls     qa+l+ ++++ +   + + + ++l+ gWk+ p
  Medtr2g034260.1 484 CM-KDDENRMILESKYFGHGIRNMVAEEGAERKSRNVKIDVWRAFFARFGMVETELSMMSLYQAELMAKRFPcGISCTFDMNGHCLLVGWKGTP 576
                      96.899******************************************************************777788889999********** PP

             GRAS 367 LvsvSaWr 374
                      + svS+W+
  Medtr2g034260.1 577 INSVSVWK 584
                      *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.213181563IPR005202Transcription factor GRAS
PfamPF035146.0E-90208584IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 587 aa     Download sequence    Send to blast
MENLCNFGDL SFNIVEDKLS SSNDIFWETN KLSEMKNVKF SVEEDLGDYN GIESLCSNFG  60
FFQDDPSQED ELLLSTDQQK YHQQPYQDYE SFDNLHFDMV QFDEQQCPTK NPPLCDTKKD  120
QQFYQTPPIE ILKNYGKGFK RLSPDEGKIH HPENESKLST EDIMKIAGTR FIQSSSLSES  180
ASGLILDHPF GFSFSGLSDE EKEDVSLAES LLACAEKVGY QQYERARKLL LQIESLSSKT  240
GNPVKRVVHY FAEALRQRID KETGRVSVST NNMKKMGPLF DPQEVTKDLN PALVAFFQDL  300
PFCKISMFTC VQTLIENVTN AKKIHVIDLE IRKGLQWTIL MQALQSRNKC PVELLKITAI  360
VTGNIETLKN IVEDTGKRLK DFARYLNIPF LFDTIIVSDL LHLREDLFKI DSEETVAVYS  420
QFALQSKIQQ SDQLETIMRV VRTINPKVMV VAEIEANHNS KSFVNRFIEA LFYFSAFFDC  480
FEDCMKDDEN RMILESKYFG HGIRNMVAEE GAERKSRNVK IDVWRAFFAR FGMVETELSM  540
MSLYQAELMA KRFPCGISCT FDMNGHCLLV GWKGTPINSV SVWKFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-382095846375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1445390.0AC144539.7 Medicago truncatula clone mth2-11o10, complete sequence.
GenBankAC1521850.0AC152185.1 Medicago truncatula chromosome 2 clone mth2-97e5, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003594755.10.0GRAS family transcription factor
TrEMBLA2Q2X90.0A2Q2X9_MEDTR; GRAS family transcription factor
STRINGGLYMA09G04110.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-59RGA-like 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]